PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015884741.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 362aa    MW: 39192.5 Da    PI: 9.6057
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015884741.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.8e-38151209462
          zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     + l+cprCds+ntkfCyynny+lsqPr+fCk+CrryWt+GG+lr++PvGgg+rkn k+s
  XP_015884741.1 151 DPLPCPRCDSNNTKFCYYNNYNLSQPRHFCKSCRRYWTQGGTLRDIPVGGGSRKNSKRS 209
                     6789***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-23126200IPR003851Zinc finger, Dof-type
PfamPF027014.3E-33152207IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.301153207IPR003851Zinc finger, Dof-type
PROSITE patternPS013610155191IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MFILAVNHHI LLYIPNQKAK AHSHKIPAEP RVLQHVRNRI LSAAPEHHLK SAHARSLSLS  60
LTLSHIEQRH AIKRCRASLP NFILSQIFCL FLFLSFTPLK TNTAERSKSI STISLKTEPK  120
KKKKMPSDSG DNRRSVKAQA QSMEHPPPQS DPLPCPRCDS NNTKFCYYNN YNLSQPRHFC  180
KSCRRYWTQG GTLRDIPVGG GSRKNSKRSR SSSSSSSSSS SSLTNTQDHL VPPIPCKSVP  240
VLPCAKPEMS SCDDLNLNEN VNGGAGFTSL LGCSSQPSGL LALGGYGLGL GQGMDEMGFG  300
YGRGGVWPFL EVGEFGNGSD GSGGSSGCNT TWQMNGADGG LVEGDCFAWP DLAISMPGKG  360
MK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015884741.10.0PREDICTED: dof zinc finger protein DOF3.4
TrEMBLF6H1E92e-69F6H1E9_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g11310.t014e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.11e-38OBF binding protein 1